Invitrogen™ Human NECAB1 (aa 9-70) Control Fragment Recombinant Protein

Product Code. 30193833

Brand: Invitrogen™ RP93775

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56695 (PA5-56695. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NECAB1 is a protein coding gene.

Specifications

• Accession Number: Q8N987
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64168
• Name: Human NECAB1 (aa 9-70) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700003H21Rik; EF hand calcium binding protein 1; EFCBP1; EF-hand calcium binding protein 1; EF-hand calcium-binding protein 1; Necab1; neuronal Ca(2+)-binding protein 1; neuronal calcium binding protein; neuronal calcium-binding protein 1; N-terminal EF-hand calcium binding protein 1; N-terminal EF-hand calcium-binding protein 1; Stip; Stip-1; synaptotagmin interacting protein 1; synaptotagmin-interacting protein 1
• Common Name: NECAB1
• Gene Symbol: NECAB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVLSGEELHELFH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining