Invitrogen™ Human NDUFV1 (aa 49-192) Control Fragment Recombinant Protein

Product Code. 30203336

Brand: Invitrogen™ RP102246

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60950. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFV1 is the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.The NDUFV1 gene encodes the 51-kD subunit of complex I (NADH:ubiquinone oxidoreductase) of the mitochondrial respiratory chain.

Specifications

• Accession Number: P49821
• Concentration: 1.8 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 4723
• Name: Human NDUFV1 (aa 49-192) Control Fragment
• pH Range: 7.4
• Purification Method: Purified
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: CI-51K; CI51KD; CI-51kD; complex I 51 kda subunit; complex I 51kDa subunit; complex I, mitochondrial respiratory chain; complex I-51kD; mitochondrial NADH dehydrogenase (ubiquinone) 51kDa subunit; mitochondrial NADH dehydrogenase ubiquinone flavoprotein 1; mitochondrial NADH:ubiquinone oxidoreductase 51 kda subunit; NADH dehydrogenase; NADH dehydrogenase (ubiquinone) flavoprotein 1; NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa; NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NADH dehydrogenase flavoprotein 1; NADH dehydrogenase flavoprotein 1; 24 kDa (FP); NADH dehydrogenase ubiquinone flavoprotein 1; NADH:ubiquinone oxidoreductase core subunit V1; NADH-ubiquinone oxidoreductase 51 kDa subunit; NDUFV1; UQOR1; wu:fc01f01; wu:fc12f12; zgc:86620
• Common Name: NDUFV1
• Gene Symbol: NDUFV1
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HDWRLKGSLSRGDWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSGYD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining