Invitrogen™ Human NDUFS5 (aa 54-101) Control Fragment Recombinant Protein

Product Code. 30182323

Brand: Invitrogen™ RP99819

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60033 (PA5-60033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Located in the mitochondrial inner membrane, mitochondrial complex I is the first and largest enzyme in the electron transport chain of oxidative phosphorylation. By oxidizing NADH that is produced in the Krebs cycle, this complex utilizes the two electrons to reduce ubiquinone to ubiquinol, thereby initiating the passage of electrons to successive complexes and ultimately leading to the reduction of oxygen to water. Mitochondrial complex I consists of over 40 subunits and is of considerable clinical interest since defects in any of the subunits can lead to various myopathies and neuropathies. As a subunit of mitochondrial complex I, NDUFS5 (NADH dehydrogenase [ubiquinone] iron-sulfur protein 5), also designated NADH-ubiquinone oxidoreductase 15 kDa subunit, is a 106 amino acid protein that is suggested to not be involved in catalysis. NDUFS5 is expressed ubiquitously in human tissues, with a relative higher expression in human heart, skeletal muscle, liver, kidney and fetal heart.

Specifications

• Accession Number: O43920
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4725
• Name: Human NDUFS5 (aa 54-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI256693; CI-15 kDa; CI15K; CI-15 k; Complex I-15 kDa; NADH dehydrogenase (ubiquinone) Fe-S protein 5; NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15 kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe-S protein 5 b, 15 kDa (NADH-coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 5; NADH:ubiquinone oxidoreductase 15 kDa IP subunit; NADH:ubiquinone oxidoreductase subunit S5; NADH-ubiquinone oxidoreductase 15 kDa subunit; Ndufs5; Ndufs5b
• Common Name: NDUFS5
• Gene Symbol: NDUFS5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining