missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NDUFB11 (aa 110-153) Control Fragment Recombinant Protein

Product Code. 30211429
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211429 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211429 Supplier Invitrogen™ Supplier No. RP95188

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56449 (PA5-56449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFB11 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. NDUFB11 functions in the transfer of electrons from NADH to the respiratory chain and is located in the inner mitochondrial membrane. The immediate electron acceptor for NDUFB11 is believed to be ubiquinone. Further, NDUFB11 is believed to have NADH dehydrogenase activity, and oxidoreductase activity. Diseases associated with NDUFB11 protein dysfunction include linear skin defects with multiple congenital anomalies and mitochondrial complex I deficiency.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NX14
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54539
Name Human NDUFB11 (aa 110-153) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CI-ESSS; complex I NP17.3 subunit; complex I-ESSS; D5Bwg0566e; D5Bwg0577e; ESSS; LSDMCA3; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3 kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; NADH:ubiquinone oxidoreductase subunit B11; NADH-ubiquinone oxidoreductase ESSS subunit; NDUFB11; Neuronal protein 15.6; neuronal protein 17.3; Np15; NP15.6; Np17.3; nuclear protein 15.6; p15.6; P17.3; RGD1563698; UNQ111/PRO1064
Common Name NDUFB11
Gene Symbol NDUFB11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.