Invitrogen™ Human NDUFB11 (aa 110-153) Control Fragment Recombinant Protein

Product Code. 30211429

Brand: Invitrogen™ RP95188

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56449 (PA5-56449. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFB11 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed not to be involved in catalysis. NDUFB11 functions in the transfer of electrons from NADH to the respiratory chain and is located in the inner mitochondrial membrane. The immediate electron acceptor for NDUFB11 is believed to be ubiquinone. Further, NDUFB11 is believed to have NADH dehydrogenase activity, and oxidoreductase activity. Diseases associated with NDUFB11 protein dysfunction include linear skin defects with multiple congenital anomalies and mitochondrial complex I deficiency.

Specifications

• Accession Number: Q9NX14
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54539
• Name: Human NDUFB11 (aa 110-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CI-ESSS; complex I NP17.3 subunit; complex I-ESSS; D5Bwg0566e; D5Bwg0577e; ESSS; LSDMCA3; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3 kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial; NADH:ubiquinone oxidoreductase subunit B11; NADH-ubiquinone oxidoreductase ESSS subunit; NDUFB11; Neuronal protein 15.6; neuronal protein 17.3; Np15; NP15.6; Np17.3; nuclear protein 15.6; p15.6; P17.3; RGD1563698; UNQ111/PRO1064
• Common Name: NDUFB11
• Gene Symbol: NDUFB11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining