Invitrogen™ Human NDUFB1 (aa 27-58) Control Fragment Recombinant Protein

Product Code. 30206383

Brand: Invitrogen™ RP105280

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66629 (PA5-66629. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDUFB1 (NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1), also known as CI-MNLL (complex I-MNLL), CI-SGDH or NADH-ubiquinone oxidoreductase MNLL subunit, is a 58 amino acid single-pass membrane protein that localizes to the matrix side of the mitochondrial membrane. A member of the complex I NDUFB1 subunit family, NDUFB1 is encoded by a gene that maps to human chromosome 14q32.12. Chromosome 14 houses over 700 genes and comprises nearly 3.5% of the human genome. Chromosome 14 encodes the presinilin 1 (PSEN1) gene, which is one of the three key genes associated with the development of Alzheimer's disease (AD). The SERPINA1 gene is also located on chromosome 14 and, when defective, leads to the genetic disorder alpha1-antitrypsin deficiency, which is characterized by severe lung complications and liver dysfunction.

Specifications

• Accession Number: O75438
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4707
• Name: Human NDUFB1 (aa 27-58) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CI-MNLL; CI-SGDH; complex I MNLL subunit; complex I-MNLL; MNLL; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7 kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1; NADH:ubiquinone oxidoreductase subunit B1; NADH-ubiquinone oxidoreductase MNLL subunit; Ndufb1
• Common Name: NDUFB1
• Gene Symbol: NDUFB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining