Invitrogen™ Human NDUFAF4 (aa 106-175) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30208364	100 μL	100µL

Product Code. 30208364 Supplier Invitrogen™ Supplier No. RP94739

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144751 (PA5-144751, PA5-61249 (PA5-61249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency.

Specifications

• Accession Number: Q9P032
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29078
• Name: Human NDUFAF4 (aa 106-175) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007M04Rik; 3000003G13Rik; AW214064; bA22L21.1; C6orf66; hormone-regulated proliferation associated protein 20; hormone-regulated proliferation-associated 20 kDa protein; hormone-regulated proliferation-associated protein of 20 kDa; Hormone-regulated proliferation-associated protein of 20 kDa homolog; hormone-regulated proliferation-associated protein, 20 kDa; Hrpap20; HSPC125; My013; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4; NADH dehydrogenase (ubiquinone) complex I, assembly factor 4; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4; NADH:ubiquinone oxidoreductase complex assembly factor 4; Ndufaf4; Protein HRPAP20
• Common Name: NDUFAF4
• Gene Symbol: NDUFAF4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining