missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NDUFAF4 (aa 106-175) Control Fragment Recombinant Protein

Product Code. 30208364
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208364

Brand: Invitrogen™ RP94739

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144751 (PA5-144751, PA5-61249 (PA5-61249. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene are a cause of mitochondrial complex I deficiency.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P032
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29078
Name Human NDUFAF4 (aa 106-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110007M04Rik; 3000003G13Rik; AW214064; bA22L21.1; C6orf66; hormone-regulated proliferation associated protein 20; hormone-regulated proliferation-associated 20 kDa protein; hormone-regulated proliferation-associated protein of 20 kDa; Hormone-regulated proliferation-associated protein of 20 kDa homolog; hormone-regulated proliferation-associated protein, 20 kDa; Hrpap20; HSPC125; My013; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 4; NADH dehydrogenase (ubiquinone) complex I, assembly factor 4; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4; NADH:ubiquinone oxidoreductase complex assembly factor 4; Ndufaf4; Protein HRPAP20
Common Name NDUFAF4
Gene Symbol NDUFAF4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKSIPKGKISIVEALTLLNNHKLFPETWTAEKIMQEYQLEQKDVNSLLKYFVTFEVEIFPPEDKKAIRSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis