Invitrogen™ Human NDUFAF1 (aa 199-279) Control Fragment Recombinant Protein

Product Code. 30181301

Brand: Invitrogen™ RP98081

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58997 (PA5-58997. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The NDUFAF1 gene encodes the human homolog of a Neurospora crassa Cia30 protein involved in the assembly of complex I.

Specifications

• Accession Number: Q9Y375
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51103
• Name: Human NDUFAF1 (aa 199-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410001M24Rik; CGI65; CGI-65; CIA30; complex I intermediate-associated protein 30, mitochondrial; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 1; NADH dehydrogenase (ubiquinone) 1 assembly factor 1; NADH dehydrogenase (ubiquinone) complex I, assembly factor 1; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1; NADH:ubiquinone oxidoreductase complex assembly factor 1; NADH-ubiquinone oxidoreductase 1 alpha subcomplex, assembly factor 1; Ndufaf1
• Common Name: NDUFAF1
• Gene Symbol: NDUFAF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining