Invitrogen™ Human NDUFA5 (aa 57-116) Control Fragment Recombinant Protein

Product Code. 30208692

Brand: Invitrogen™ RP100136

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60270 (PA5-60270. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Specifications

• Accession Number: Q16718
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4698
• Name: Human NDUFA5 (aa 57-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900002J19Rik; B13; CI-13 kB; CI-13 kD-B; complex I 13 kDa subunit B; complex I subunit B13; Complex I-13 kD-B; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13 kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; NADH ubiquinone oxidoreductase subunit B13; NADH:ubiquinone oxidoreductase subunit A5; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; NADHUO; NDUFA5; NUFM; type I dehydrogenase; ubiquinone reductase; UQOR13
• Common Name: NDUFA5
• Gene Symbol: NDUFA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining