Invitrogen™ Human NDUFA13 (aa 50-144) Control Fragment Recombinant Protein

Product Code. 30181996

Brand: Invitrogen™ RP99065

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59482 (PA5-59482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

A novel gene associated with Retinoid-IFN-induced Mortality (GRIM) GRIM-19 gene was identified. Antisense expression of GRIM-19 confers a strong resistance against IFN/RA-induced death by reducing the intracellular levels of GRIM-19 protein. Overexpression of GRIM-19 enhances cell death in response to IFN/RA. GRIM-19 is primarily a nuclear protein whose expression is induced by the IFN/RA combination. These data indicate that GRIM-19 is a novel cell death-regulatory molecule.

Specifications

• Accession Number: Q9P0J0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51079
• Name: Human NDUFA13 (aa 50-144) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700054G14Rik; AU022060; B16.6; CDA016; Cell d; Cell death regulatory protein GRIM-19; cell death-regulatory protein GRIM19; CGI-39; CI-B16.6; complex I B16.6 subunit; complex I-B16.6; FLJ58045; FLJ59191; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein; Gene associated with retinoic-interferon-induced mortality 19 protein; genes associated with retinoid-IFN-induced mortality 19; GRIM19; GRIM-19; LOC100911483; mitochondrial NADH:ubiquinone oxidoreductase B16.6 subunit; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13-like; NADH:ubiquinone oxidoreductase subunit A13; NADH-ubiquinone oxidoreductase B16.6 subunit; Ndufa13; YjeF N-terminal domain-containing protein 3; YjeF_N3; Yjefn3
• Common Name: NDUFA13
• Gene Symbol: Ndufa13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining