missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200217

Invitrogen™ Human NDUFA10 (aa 30-152) Control Fragment Recombinant Protein

Product Code. 30200217
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200217

Brand: Invitrogen™ RP105132

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84423 (PA5-84423. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a component of 42 kDa complex I, the first enzyme complex in the electron transport chain of mitochondria. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. A mutation in this gene was found in an individual with Leigh syndrome.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number O95299
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4705
Name Human NDUFA10 (aa 30-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2900053E13Rik; CI-42 k; CI-42 KD; complex I 42 kDa subunit; complex I-42 kD; FLJ21923; MGC5103; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42 kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; NADH:ubiquinone oxidoreductase subunit A10; NADH-ubiquinone oxidoreductase 42 kDa subunit; Ndufa10; ndufa10l
Common Name NDUFA10
Gene Symbol NDUFA10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSVQCKLRYGMWHFLLGDKASKRLTERSRVITVDGNICTGKGKLAKEIAEKLGFKHFPEAGIHYPDSTTGDGKPLATDYNGNCSLEKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.