Invitrogen™ Human NDRG2 (aa 40-149) Control Fragment Recombinant Protein

Product Code. 30198873

Brand: Invitrogen™ RP89063

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51970 (PA5-51970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NDRG2's gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Specifications

• Accession Number: Q9UN36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57447
• Name: Human NDRG2 (aa 40-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI182517; antidepressant-related protein ADRG123; AU040374; cytoplasmic protein Ndr1; DKFZp781G1938; FLJ25522; Kiaa1248; NDR1-related protein NDR2; Ndr2; NDRG family member 2; NDRG1-related protein; NDRG2; NDRG2var; N-myc downstream regulated 2; N-Myc downstream regulated gene 2; N-myc downstream regulator 2; N-myc downstream-regulated gene 2; N-myc downstream-regulated gene 2 protein; Protein Ndr2; protein NDRG2; Protein Syld709613; SYLD; syld709613 protein
• Common Name: NDRG2
• Gene Symbol: NDRG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: THSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining