Invitrogen™ Human NDFIP2 (aa 39-114) Control Fragment Recombinant Protein

Product Code. 30203135

Brand: Invitrogen™ RP89600

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52657 (PA5-52657. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus and multivesicular body where it mediates KCNH2 degradation (PubMed:26363003). May modulate EGFR signaling. Together with NDFIP1, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination. [UniProt]

Specifications

• Accession Number: Q9NV92
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54602
• Name: Human NDFIP2 (aa 39-114) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0710001O20Rik; 2810436B12Rik; 9130207N19Rik; KIAA1165; MAPK-activating protein PM04 PM05 PM06 PM07; mKIAA1165; N4wbp5a; NDFIP2; Nedd4 family interacting protein 2; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5 A; NF-kappa-B-activating protein 413; putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413; Unknown (protein for IMAGE:7958216); wu:fa92h03; wu:fk31f07; zgc:63948
• Common Name: NDFIP2
• Gene Symbol: NDFIP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining