Invitrogen™ Human NCOA7 (aa 474-548) Control Fragment Recombinant Protein

Product Code. 30198584

Brand: Invitrogen™ RP94662

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56428 (PA5-56428. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NCOA7 enhances the transcriptional activities of several nuclear receptors. It is involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA.

Specifications

• Accession Number: Q8NI08
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 135112
• Name: Human NCOA7 (aa 474-548) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 140 kDa estrogen receptor-associated protein; 9030406N13Rik; dJ187J11.3; ERAP140; ESNA1; Estrogen nuclear receptor coactivator 1; estrogen receptor associated protein 140 kDa; Nbla00052; Nbla10993; Ncoa7; NCOA7-AS; Nuclear receptor coactivator 7; putative protein product of Nbla00052; putative protein product of Nbla10993; RGD1566426; TBC/LysM-associated domain containing 4; TLDC4
• Common Name: NCOA7
• Gene Symbol: NCOA7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining