Invitrogen™ Human NCOA4 (aa 524-613) Control Fragment Recombinant Protein

Product Code. 30209901

Brand: Invitrogen™ RP103588

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-65653 (PA5-65653, PA5-64203 (PA5-64203. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Androgen receptor (AR) coactivator ARA70, also designated NCOA4, RFG and ELE1, is a putative co-activator that specifically enhances the activity of the androgen receptor. In human thyroid carcinomas, the Ret proto-oncogene fuses to ARA70 to form Ret/PTC3 by an intrachromosomal inversion of chromosome in vivo. ARA70 is expressed as two isoforms, ARA70a and ARA70b. The shorter variant, ARA70b, results from an internal 985-bp deletion. ARA70a is widely expressed, and its expression is highest in testis and adipose tissues, whereas ARA70b is solely expressed in the testis. ARA70a can function as a ligand-enhanced co-activator of PPARg in adipocytes. ARA70 may be involved in prostate carcinogenesis and ovarian cancer and may serve as a key mediator of estrogen-androgen synergism.

Specifications

• Accession Number: Q13772
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8031
• Name: Human NCOA4 (aa 524-613) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 70 kDa androgen receptor coactivator; 70 kDa AR-activator; Androgen receptor coactivator 70 kDa protein; Androgen receptor-associated protein of 70 kDa; ARA70; ELE1; NCOA4; NCoA-4; Nuclear receptor coactivator 4; PTC3; ret fused; RET-activating gene ELE1; Ret-activating protein ELE1; RFG
• Common Name: NCOA4
• Gene Symbol: NCOA4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining