Invitrogen™ Human NCKIPSD (aa 100-174) Control Fragment Recombinant Protein

Product Code. 30200777

Brand: Invitrogen™ RP104887

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65592 (PA5-65592. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified.

Specifications

• Accession Number: Q9NZQ3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51517
• Name: Human NCKIPSD (aa 100-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 54 kDa VacA-interacting protein; 54 kDa vimentin-interacting protein; 90 kDa N-WASP-interacting protein; 90 kDa SH3 protein interacting with Nck; AF3P21; dia interacting protein; dia-interacting protein 1; diaphanous protein interacting protein; Diaphanous protein-interacting protein; DIP; DIP1; DIP-1; mDia interacting protein-1; MGC23891; NCK interacting protein with SH3 domain; NCK-interacting protein with SH3 domain; Nckipsd; N-WASP-binding protein; ORF1; SH3 adapter protein SPIN90; SH3 protein interacting with Nck, 90 kDa; Spin90; VIP54; Wasbp; WASLBP; WASP-interacting SH3-domain protein; WISH; Wiskott-Aldrich syndrome homolog binding protein; Wiskott-Aldrich syndrome protein-binding protein; wiskott-Aldrich syndrome protein-binding protein WISH; wiskott-Aldrich syndrome protein-interacting protein
• Common Name: NCKIPSD
• Gene Symbol: NCKIPSD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining