Invitrogen™ Human NCKAP5 (aa 501-581) Control Fragment Recombinant Protein

Product Code. 30193555

Brand: Invitrogen™ RP96205

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56999 (PA5-56999. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NCKAP5 (NCK Associated Protein 5) is a Protein Coding gene. An important paralog of this gene isNCKAP5L.

Spécification

• Accession Number: O14513
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 344148
• Name: Human NCKAP5 (aa 501-581) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 8430408F21; D130011D22Rik; E030049G20Rik; ERIH; ERIH1; Erih2; Gm1548; NAP5; NAP-5; NCK associated protein 5; NCKAP5; NCK-associated protein 5; Peripheral clock protein; peripheral clock protein 2; RGD1564507
• Common Name: NCKAP5
• Gene Symbol: NCKAP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SKLTHSVSDSLFGWETNRKHFLEGTSSVYPKERPEKLTSCASSCPLEMKLCPSVQTPQVQRERGPQGQGHGRMALNLQLSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining