missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NCAPH2 (aa 356-449) Control Fragment Recombinant Protein

Product Code. 30194078
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194078

Brand: Invitrogen™ RP105440

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66964 (PA5-66964. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Structural maintenance of chromosomes (SMC) and non-SMC condensin proteins associate into complexes that have been implicated in the process of chromosome condensation. A crucial prerequisite for accurate segregation of replicated sister chromatids is the condensation of the chromosomes into a manageable form prior to metaphase. The condensin I complex consists of two SMC subunits, SMC2 and SMC4, and three non-SMC subunits, CAP-H, CAP-G, and CAP-D2. An alternative complex, the condensin II complex, contains alternate non-SMC subunits, CAP-G2, CAP-H2, and CAP-D3. CAP-H2 is also known as Non-SMC condensin II complex, subunit H2 (NCAPH2) or kleisin beta isoform 2. The three non-SMC subunits in the condensing complexes form a regulatory subcomplex that is required to activate the SMC ATPases and to promote mitosis-specific chromatin binding of the holocomplex. The precise individual functions of each non-SMC protein in activation remain to be determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6IBW4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29781
Name Human NCAPH2 (aa 356-449) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CAPH2; CAP-H2 subunit of the condensin II complex; Chromosome-associated protein H2; condensin-2 complex subunit H2; CTA-384D8.36; D15Ertd785e; hCAP-H2; kleisin beta; Kleisin-beta; Ncaph2; Non-SMC condensin II complex subunit H2; non-SMC condensin II complex, subunit H2
Common Name NCAPH2
Gene Symbol NCAPH2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AAKLQDFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.