Invitrogen™ Human NCAPD3 (aa 688-784) Control Fragment Recombinant Protein

Product Code. 30202312

Brand: Invitrogen™ RP105978

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65262 (PA5-65262. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein is a regulatory subunit of the condensin-2 complex, a complex which establishes mitotic chromosome architecture and is involved in physical rigidity of the chromatid axis.

Specifications

• Accession Number: P42695
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23310
• Name: Human NCAPD3 (aa 688-784) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810487N22Rik; 4632407J06Rik; AI195468; AU018739; B130055D15Rik; CAPD3; CAP-D3; Condensin-2 complex subunit D3; hCAP-D3; hcp-6; hHCP-6; Jacobsen syndrome region 2; Kiaa0056; mKIAA0056; NCAPD3; Non-SMC condensin II complex subunit D3; non-SMC condensin II complex, subunit D3
• Common Name: NCAPD3
• Gene Symbol: NCAPD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFHIWSKKEKFSPTFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLPKSTRDKVTDAVKCK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining