Invitrogen™ Human NCAPD2 (aa 729-834) Control Fragment Recombinant Protein

Product Code. 30182591

Brand: Invitrogen™ RP97626

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57919 (PA5-57919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. May target the condensin complex to DNA via its C-terminal domain (PubMed:11136719). May promote the resolution of double-strand DNA catenanes (intertwines) between sister chromatids. Condensin-mediated compaction likely increases tension in catenated sister chromatids, providing directionality for type II topoisomerase-mediated strand exchanges toward chromatid decatenation. Required for decatenation of non-centromeric ultrafine DNA bridges during anaphase. Early in neurogenesis, may play an essential role to ensure accurate mitotic chromosome condensation in neuron stem cells, ultimately affecting neuron pool and cortex size (PubMed:27737959). [UniProt]

Specifications

• Accession Number: Q15021
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9918
• Name: Human NCAPD2 (aa 729-834) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810406C15Rik; 2810465G24Rik; Capd2; CAP-D2; chromosome condensation related SMC associated protein 1; chromosome condensation-related SMC-associated protein 1; Chromosome-associated protein D2; CNAP1; Condensin complex subunit 1; hCAP-D2; KIAA0159; mCAP-D2; mKIAA0159; Ncapd2; Non-SMC condensin I complex subunit D2; non-SMC condensin I complex, subunit D2; RGD1562596; XCAP-D2 homolog
• Common Name: NCAPD2
• Gene Symbol: NCAPD2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGMMARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining