Invitrogen™ Human NCAM2 (aa 206-279) Control Fragment Recombinant Protein

Product Code. 30195676

Brand: Invitrogen™ RP95877

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56584 (PA5-56584. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NCAM2 (neural cell adhesion molecule 2) is a cell adhesion molecule belonging to the immunoglobulin superfamily. It is differentially expressed in the developing and mature olfactory epithelium and is involved in the guidance of developing olfactory sensory neurons to the glomeruli of the olfactory bulb.

Specifications

• Accession Number: O15394
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4685
• Name: Human NCAM2 (aa 206-279) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: fasciclin II; NCAM2; N-CAM-2; Ncam-2; NCAM21; neural cell adhesion molecule 2; Neural cell adhesion molecule RB-8; Ocam; OCAM-GPI; olfactory axon cell adhesion molecule; R4B12; R4B12 antigen; Rncam
• Common Name: NCAM2
• Gene Symbol: NCAM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NVPPAISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining