missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human NBR1 (aa 83-162) Control Fragment Recombinant Protein

Product Code. 30208980
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208980

Brand: Invitrogen™ RP105752

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64993 (PA5-64993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14596
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4077
Name Human NBR1 (aa 83-162) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1A13B; 1A1-3 B; B-box protein; Ca125; Cell migration-inducing gene 19 protein; IAI3B; KIAA0049; M17S2; Membrane component chromosome 17 surface marker 2; Membrane component chromosome 17 surface marker 2 homolog; membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125); MIG19; migration-inducing protein 19; mKIAA0049; Nbr1; NBR1, autophagy cargo receptor; neighbor of Brca1 gene 1; neighbor of BRCA1 gene 1 protein; Next to BRCA1 gene 1 protein; next to the Brca1; ovarian carcinoma antigen CA125; Protein 1A1-3 B; RGD1311421
Common Name NBR1
Gene Symbol NBR1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRVLGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.