missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198684

Invitrogen™ Human NBL1 (aa 20-166) Control Fragment Recombinant Protein

Product Code. 30198684
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198684

Brand: Invitrogen™ RP88778

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110726 (PA5-110726. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is the founding member of the evolutionarily conserved CAN family of proteins, which contain a domain resembling the CTCK motif found in a number of signaling molecules. These proteins are secreted, and act as BMP antagonists by binding to BMPs and preventing them from interacting with their receptors. They may thus play an important role during growth and development. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P41271
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4681
Name Human NBL1 (aa 20-166) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias D1S1733E; D4H1S1733E; DAN; DAN domain family member 1; Dana; DAND1; differential screening-selected gene aberrant in neuroblastoma; N03; NB; Nbl1; neuroblastoma 1, DAN family BMP antagonist; neuroblastoma candidate region, suppression of tumorigenicity 1; neuroblastoma suppressor of tumorigenicity 1; neuroblastoma, suppression of tumorigenicity 1; Neuroblastoma, suppression of tumorigenicity 1 (DNA segment human D1S1733E); NO3; Protein N03; Zinc finger protein DAN
Common Name NBL1
Gene Symbol Nbl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.