missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210757

Invitrogen™ Human NAT9 (aa 1-67) Control Fragment Recombinant Protein

Product Code. 30210757
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210757

Brand: Invitrogen™ RP93220

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54521 (PA5-54521. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAT-9 (N-acetyltransferase 9), also known as EBSP (embryo brain-specific protein), is a 207 amino acid protein belonging to the acetyltransferase family and the GNAT subfamily. Containing a N-acetyltransferase domain, NAT-9 may be associated with psoriasis and psoriatic arthritis, a type of inflammatory/autoimmune disease that affects skin, tendons and/or joints of the hands and feet. Expressed as two isoforms produced by alternative splicing events, NAT-9 is encoded by a gene located on human chromosome 17, which comprises over 2.5% of the human genome and encodes over 1,200 genes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BTE0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26151
Name Human NAT9 (aa 1-67) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EBS; EBSP, hNATL; embryo brain specific protein; Embryo brain-specific protein; N-acetyltransferase 9; N-acetyltransferase 9 (GCN5-related, putative); N-acetyltransferase 9 (putative); NAT9
Common Name NAT9
Gene Symbol NAT9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MRLNQNTLLLGKKVVLVPYTSEHVPRYHEWMKSEELQRLTASEPLTLEQEYAMQCSWQEDADKCTFI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.