missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194475

Invitrogen™ Human NAT8 (aa 80-145) Control Fragment Recombinant Protein

Product Code. 30194475
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194475

Brand: Invitrogen™ RP108240

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84770 (PA5-84770. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This protein, isolated using the differential display method to detect tissue-specific genes, is specifically expressed in kidney and liver. The encoded protein shows amino acid sequence similarity to N-acetyltransferases. A similar protein in Xenopus affects cell adhesion and gastrulation movements, and may be localized in the secretory pathway. A highly similar paralog is found in a cluster with this gene.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9UHE5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9027
Name Human NAT8 (aa 80-145) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610037O16Rik; Acetyltransferase 2; ATase2; camello-like 4; camello-like protein 1; Camello-like protein 4; CCNAT; CML1; Cml4; Cysteinyl-conjugate N-acetyltransferase; GLA; Hcml1; kidney- and liver-specific gene product; N-acetyltransferase 8; N-acetyltransferase 8 (camello like); N-acetyltransferase 8 (GCN5-related, putative); N-acetyltransferase 8 (putative); NAT8; probable N-acetyltransferase 8; probable N-acetyltransferase CML4; putative N-acetyltransferase Camello 4; TSC501; TSC510
Common Name NAT8
Gene Symbol NAT8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KPWTEYVDMTLCTDMSDITKSYLSERGSCFWVAESEEKVVGMVGALPVDDPTLREKRLQLFHLFVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.