Invitrogen™ Human NARFL (aa 250-343) Control Fragment Recombinant Protein

Product Code. 30182308

Brand: Invitrogen™ RP98667

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59325 (PA5-59325. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. Seems to negatively regulate the level of HIF1A expression, although this effect could be indirect.

Specifications

• Accession Number: Q9H6Q4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64428
• Name: Human NARFL (aa 250-343) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9030612I22Rik; AI504405; CIAO3; Cytosolic Fe-S cluster assembly factor NARFL; Cytosolic iron-sulfur assembly component 3; HPRN; IOP1; iron-only hydrogenase-like protein 1; LET1 like/JFP15; LET1L; NAR1; NARFL; nuclear prelamin A recognition factor like; nuclear prelamin A recognition factor-like; nuclear prelamin A recognition factor-like protein; PRN; protein related to Narf
• Common Name: NARFL
• Gene Symbol: Narfl
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLEASRPDFFNQEHQTRDVDCVLTTGEVFRLLEEEGVSLPDLEPAPLDSLCSGASAEEPTSHRGGGSGGYLEHVFRHAARELFGIHVAEVTYKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining