Invitrogen™ Human Nardilysin (aa 1068-1138) Control Fragment Recombinant Protein

Product Code. 30206749

Brand: Invitrogen™ RP104972

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65810 (PA5-65810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.

Specifications

• Accession Number: O43847
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4898
• Name: Human Nardilysin (aa 1068-1138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2600011I06Rik; AI875733; hNRD1; hNRD2; nardilysin; nardilysin (N-arginine dibasic convertase); nardilysin 1; nardilysin 1 (N-arginine dibasic convertase); nardilysin convertase; nardilysin, N-arginine dibasic convertase 1; nardilysin, N-arginine dibasic convertase, NRD convertase 1; N-arginine dibasic convertase; N-arginine dibasic convertase 1; NRD convertase; Nrd1; NRDC; NRD-C
• Common Name: Nardilysin
• Gene Symbol: Nrdc
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining