Invitrogen™ Human NAPSA (aa 238-268) Control Fragment Recombinant Protein

Product Code. 30201306

Brand: Invitrogen™ RP100024

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60970 (PA5-60970. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Napsin 1 is an aspartic protease that is generally expressed in the lung, but also present in kidney and in metastatic carcinomas throughout the body. Napsin 1 processes surfactant protein B in healthy pulmonary and renal tissues, but is abnormally regulated when carcinogenesis occurs. Thus, many researchers have found napsin evaluation to be useful in identifying several cancers, and differentiating primary tumors from metastases. When combined with thyroid transcription factor analysis, napsin can be used as a specific biomarker for differentiation of carcinoma types. Napsin has also been associated with pulmonary alveolar proteinosis as well as in protein catabolism in renal tubules.

Specifications

• Accession Number: O96009
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9476
• Name: Human NAPSA (aa 238-268) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; KDAP-1; kidney-derived aspartic protease-like protein; Nap; NAP1; NAPA; Napsa; napsin A aspartic peptidase; napsin-1; Napsin-A; pronapsin; pronapsin A; SNAPA; TA01/TA02
• Common Name: NAPSA
• Gene Symbol: NAPSA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining