Invitrogen™ Human NAP1L2 (aa 299-343) Control Fragment Recombinant Protein

Produktkod. 30211993

Brand: Invitrogen™ RP101566

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84327 (PA5-84327. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Acidic protein which may be involved in interactions with other proteins or DNA.

Specifikationer

• Accession Number: Q9ULW6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4674
• Name: Human NAP1L2 (aa 299-343) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Bpx; brain specific gene BPX; brain-specific protein, X-linked; Nap1l2; nucleosome assembly protein 1 like 2; nucleosome assembly protein 1-like 2
• Common Name: NAP1L2
• Gene Symbol: NAP1L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining