Invitrogen™ Human NAP1L1 (aa 1-75) Control Fragment Recombinant Protein

Product Code. 30202421

Brand: Invitrogen™ RP101066

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55993 (PA5-55993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAP1L1 is a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation.

Specifications

• Accession Number: P55209
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4673
• Name: Human NAP1L1 (aa 1-75) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA407126; AI256722; Brain protein DN38; D10Ertd68e; hNRP; HSP22-like protein interacting protein; NAP1; NAP-1; NAP1L; NAP1L1; NAP-1-related protein; NRP; nucleosome assembly protein 1 like 1; nucleosome assembly protein 1-like 1; nucleosome assembly protein-1
• Common Name: NAP1L1
• Gene Symbol: Nap1l1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining