Invitrogen™ Human NANS (aa 281-354) Control Fragment Recombinant Protein

Product Code. 30206652

Brand: Invitrogen™ RP92893

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53960 (PA5-53960. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an enzyme that functions in the biosynthetic pathways of sialic acids. In vitro, the encoded protein uses N-acetylmannosamine 6-phosphate and mannose 6-phosphate as substrates to generate phosphorylated forms of N-acetylneuraminic acid (Neu5Ac) and 2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN), respectively; however, it exhibits much higher activity toward the Neu5Ac phosphate product. In insect cells, expression of this gene results in Neu5Ac and KDN production. This gene is related to the E. coli sialic acid synthase gene neuB, and it can partially restore sialic acid synthase activity in an E. coli neuB-negative mutant.

Specifications

• Accession Number: Q9NR45
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54187
• Name: Human NANS (aa 281-354) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4632418E04Rik; BB056474; epididymis secretory protein Li 100; HEL-S-100; N-acetylneuraminate synthase; N-acetylneuraminate-9-phosphate synthase; N-acetylneuraminic acid 9-phosphate synthetase; N-acetylneuraminic acid phosphate synthase; N-acetylneuraminic acid synthase; N-acetylneuraminic acid synthase (sialic acid synthase); Nans; RP11-404F11.3; SAS; SEMDG; sialic acid phosphate synthase; sialic acid synthase
• Common Name: NANS
• Gene Symbol: NANS
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining