Invitrogen™ Human NANOS3 (aa 13-84) Control Fragment Recombinant Protein

Product Code. 30207693

Brand: Invitrogen™ RP103481

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64081 (PA5-64081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Nanos is a zinc-finger containing, RNA-binding protein that has been implicated in germ cell development in both invertebrates and vertebrates. In Drosophila, Nanos represses apoptosis during development to ensure proper germ-line development. Unlike Nanos1 whose expression in mice is dispensable, the Nanos2 and Nanos3 proteins are required for germ cell development. Nanos2-null primordial germ cells (PGCs) die only in the male gonads and show no defects in females, while Nanos3-null PGCs are lost during the migration stage regardless of sex. Nanos2 and Nanos3 have distinct expression patterns during embryo development, suggesting that these two proteins do not have redundant functions. However, expression of Nanos2 can at least partially replace Nanos3 function in a Nanos3-null background. Nanos3 expression can not rescue Nanos2-null defects.

Specifications

• Accession Number: P60323
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 342977
• Name: Human NANOS3 (aa 13-84) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: nanos C2HC-type zinc finger 3; nanos homolog 3; nanos homolog 3 (Drosophila); NANOS1L; NANOS3; NOS3; NOS-3; ZC2HC12C
• Common Name: NANOS3
• Gene Symbol: NANOS3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining