missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212376

Invitrogen™ Human NANOS2 (aa 1-138) Control Fragment Recombinant Protein

Product Code. 30212376
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212376

Brand: Invitrogen™ RP89533

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53131 (PA5-53131. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NANOS2 is a gene that encodes for a protein found in the testes and ovaries. It is a member of the NANOS family of proteins and plays a crucial role in the regulation of germ cell development. NANOS2 is involved in the maintenance of germ cell pluripotency and the suppression of somatic cell differentiation. It is also involved in the regulation of meiosis and the formation of gametes. Mutations in the NANOS2 gene have been associated with various reproductive disorders, including infertility and testicular germ cell tumors. NANOS2 is a target of research in the fields of reproductive biology and genetics.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P60321
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 339345
Name Human NANOS2 (aa 1-138) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias nanos C2HC-type zinc finger 2; nanos homolog 2; nanos homolog 2 (Drosophila); NANOS2; nos2; NOS-2; RGD1562436; ZC2HC12B
Common Name NANOS2
Gene Symbol NANOS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.