Invitrogen™ Human NALP5 (aa 399-513) Control Fragment Recombinant Protein

Product Code. 30181643

Brand: Invitrogen™ RP99156

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144816 (PA5-144816, PA5-63277 (PA5-63277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP proteins include the apoptosis regulator APAF1 (apoptotic protease activating factor 1) and mammalian NOD-LRR proteins and are thought to be involved in inflammation and reproduction. NALP5, also known as MATER, is a maternal gene required for early embryonic development in mice. Increased NALP5 expression was observed in two neuronal injury models, and transient expression of recombinant NALP5 in neurons induced caspase-3 activation and apoptosis, suggesting that NALP5 also plays a role in caspase activation and apoptosis in injured neurons, and may thus represent a novel target for therapeutic treatment in neurodegenerative disorders.

Specifications

• Accession Number: P59047
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 126206
• Name: Human NALP5 (aa 399-513) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLR19.8; MATER; Mater protein; Mater protein homolog; maternal antigen that embryos require; NACHT, leucine rich repeat and PYD containing 5; NACHT, LRR and PYD domains-containing protein 5; Nalp5; NLR family pyrin domain containing 5; NLR family, pyrin domain containing 5; NLRP5; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 5; Ooplasm-specific protein 1; OP1; PAN11; PYPAF8
• Common Name: NALP5
• Gene Symbol: NLRP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLPESFLIVTVRDVGTEKLKSEVVSPRYLLVRGISGEQRIHLLLERGIGEHQKTQGLRAIMNNRELLDQCQVPAVGSLICVALQLQDVVGESVAPFNQTLTGLHAAFVFHQLTPR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining