Invitrogen™ Human NALP4 (aa 701-792) Control Fragment Recombinant Protein

Product Code. 30210331

Brand: Invitrogen™ RP109015

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139855 (PA5-139855. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP proteins include the apoptosis regulator APAF1 (apoptotic protease activating factor 1) and mammalian NOD-LRR proteins and are thought to be involved in inflammation and reproduction. NALP4, also known as PYRIN-containing APAF1-like protein 4, has a C-terminal leucine-rich repeat (LRR) region, an N-terminal Pyrin domain (PYD) followed by a NACHT domain, and a NACHT-associated domain. In transfected 293 cells, NALP4 suppressed NF-kappa-B induction by TNF-a and IL-1-b, suggesting NALP4 operates at a point of convergence in these two signaling pathways. NALP4 also suppressed NF-kappa-B induction resulting from overexpression of several adapter proteins and protein kinases involved in these pathways, including TRAF2, TRAF6, RIP, and IRAK2, as well as the IKK-alpha and IKK-beta, suggesting that NALP4 is critical in modulating NF-kappa-B activity.

Specifications

• Accession Number: Q96MN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 147945
• Name: Human NALP4 (aa 701-792) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930406H16Rik; cancer/testis antigen 58; CLR19.5; CT58; E330021B02; E330028A19Rik; NACHT, leucine rich repeat and PYD containing 4; NACHT, leucine rich repeat and PYD containing 4 A; NACHT, leucine rich repeat and PYD containing 4 E; NACHT, LRR and PYD containing protein 4; NACHT, LRR and PYD domains-containing protein 4; NACHT, LRR and PYD domains-containing protein 4 A; NACHT, LRR and PYD domains-containing protein 4 E; NACHT/LRR/pyrin domain-containing protein 4; NALP, epsilon; NALP4; Nalp4a; Nalp4e; NALP-epsilon; Nalp-eta; Nalp-ita; NLR family pyrin domain containing 4; NLR family, pyrin domain containing 4; NLR family, pyrin domain containing 4 A; NLR family, pyrin domain containing 4 E; Nlrp4; Nlrp4a; Nlrp4e; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 4; PAAD and NACHT-containing protein 2; PAN2; PYPAF4; PYRIN and NACHT-containing protein 2; PYRIN-containing APAF1-like protein 4; RGD1561918; RGD1563529; Ribonuclease inhibitor 2; RNH2
• Common Name: NALP4
• Gene Symbol: NLRP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FTLTKLSRDDIRSLCDALNYPAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLTYLNVSCNQLDTGVPLLCEALCSPDTVLVYLMLAFCHLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining