missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180999

Invitrogen™ Human NALP13 (aa 17-121) Control Fragment Recombinant Protein

Product Code. 30180999
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180999

Brand: Invitrogen™ RP99157

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63859 (PA5-63859. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP proteins are cytoplasmic proteins that form a subfamily within the larger CATERPILLER family and are thought to play a crucial role in cell proliferation and reproduction. Like all other NALP family members, NALP13 has a C-terminal leucine-rich repeat (LRR) region, an N-terminal Pyrin domain (PYD) followed by a NACHT domain, and a NACHT-associated domain. While little is known about the function of NALP13, it has been suggested that it may be implicated in the activation of proinflammatory caspases via inflammasomes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q86W25
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 126204
Name Human NALP13 (aa 17-121) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CLR19.7; NACHT, leucine rich repeat and PYD containing 13; NACHT, LRR and PYD containing protein 13; NACHT, LRR and PYD domains-containing protein 13; NALP13; NLR family pyrin domain containing 13; NLR family, pyrin domain containing 13; NLRP13; NOD14; Nucleotide-binding oligomerization domain protein 14; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 13; PAN13
Common Name NALP13
Gene Symbol NLRP13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLPYLMALDQYQLEEFKLCLEPQQLMDFWSAPQGHFPRIPWANLRAADPLNLSFLLDEHFPKGQAWKVVLGIFQTMNLTSLCEKVRAEMKENVQTQELQDPTQED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.