Invitrogen™ Human NALP12 (aa 654-727) Control Fragment Recombinant Protein

Product Code. 30182376

Brand: Invitrogen™ RP99104

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60185 (PA5-60185. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP proteins are cytoplasmic proteins that form a subfamily within the larger CATERPILLER family and are thought to play a crucial role in cell proliferation and reproduction. Like all other NALP family members, NALP12, also known as Monarch-1, has a C-terminal leucine-rich repeat (LRR) region, an N-terminal Pyrin domain (PYD) followed by a NACHT domain, and a NACHT-associated domain. NALP12 is thought to act as an attenuating factor of inflammation by suppressing inflammatory responses such as NF-kappa-B activation by TLR-signaling molecules MyD88, IRAK-1, TRAF6 and RIPK1 in activated monocytes. Recent evidence suggests that mutations in NALP12 result in hereditary periodic fever syndromes.

Specifications

• Accession Number: P59046
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91662
• Name: Human NALP12 (aa 654-727) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLR19.3; FCAS2; monarch 1; monarch-1; NACHT, leucine rich repeat and PYD containing 12; NACHT, LRR and PYD containing protein 12; NACHT, LRR and PYD domains-containing protein 12; NALP12; NLR family pyrin domain containing 12; NLR family, pyrin domain containing 12; Nlrp12; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 12; PAN6; PYPAF7; PYRIN-containing APAF1-like protein 7; regulated by nitric oxide; RNO; RNO2
• Common Name: NALP12
• Gene Symbol: NLRP12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKRCRSAQVLHLYGATYSADGEDRARCSAGAHTLLVQLPERTVLLDAYSEHLAAALCTNPNLIELSLYRNALGS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining