Invitrogen™ Human NALP11 (aa 635-734) Control Fragment Recombinant Protein

Product Code. 30201976

Brand: Invitrogen™ RP108698

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP11 is a 1033 amino acid containing cytoplasmic protein belonging to the NLRP family with a DAPIN domain, six LRR (leucine-rich) repeats and a NACHT domain. Reports suggest that it is a short NALP involved in inflammation potential. NALP proteins are implicated in the activation of proinflammatory caspases (e.g., CASP1) via their involvement in multiprotein complexes called inflammasomes. The DAPIN domain is necessary and sufficient for suppression of NF-kappa B activation induced by TNF and for inducing IL-1B secretion in collaboration with Caspase-1. It is involved in interaction with PYCARD.

Specifications

• Accession Number: P59045
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 204801
• Name: Human NALP11 (aa 635-734) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CLR19.6; NACHT, leucine rich repeat and PYD containing 11; NACHT, LRR and PYD domains-containing protein 11; NALP11; NLR family pyrin domain containing 11; NLR family, pyrin domain containing 11; NLRP11; NOD17; Nucleotide-binding oligomerization domain protein 17; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 11; PAAD- and NACHT-containing protein 10 B; PAAD-and NACHT domain-containing protein 10; PAN10; PYPAF6; PYPAF7; PYRIN-containing APAF1-like protein 6
• Common Name: NALP11
• Gene Symbol: NLRP11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining