Invitrogen™ Human NALP1 (aa 1130-1261) Control Fragment Recombinant Protein

Product Code. 30210733

Brand: Invitrogen™ RP107337

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111579 (PA5-111579. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NALP1 is a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like motif, which is possibly involved in protein-protein interactions. This protein interacts strongly with caspase 2 and weakly with caspase 9. Overexpression of this gene was demonstrated to induce apoptosis in cells. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the biological validity of some variants has not been determined.

Specifications

• Accession Number: Q9C000
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22861
• Name: Human NALP1 (aa 1130-1261) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CARD7; caspase recruitment domain protein; caspase recruitment domain protein 7; caspase recruitment domain-containing protein 7; CIDED; CLR17.1; death effector filament-forming Ced-4-like apoptosis protein; DEFCAP; DEFCAP-L/S; DKFZp586O1822; Gm14; Gm15; KIAA0926; NAC; nacht; NACHT, leucine rich repeat and PYD (pyrin domain) containing 1; NACHT, leucine rich repeat and PYD containing 1; NACHT, LRR and PYD containing protein 1; NACHT, LRR and PYD domains-containing protein 1; NACHT, LRR and PYD domains-containing protein 1 A; NACHT/LRR/pyrin domain-containing protein 1; Nalp1; Nalp1a; NLR family protein 1; NLR family pyrin domain containing 1; NLR family, pyrin domain containing 1; NLR family, pyrin domain containing 1 A; Nlrp1; Nlrp1a; Nucleotide-binding domain and caspase recruitment domain; nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 1; PP1044; resistant anthrax lethal toxin; SLEV1; VAMAS1
• Common Name: NALP1
• Gene Symbol: NLRP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CVWDQFLGEINPQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARVELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining