Invitrogen™ Human NAF1 (aa 242-335) Control Fragment Recombinant Protein

Product Code. 30196689

Brand: Invitrogen™ RP96681

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57582 (PA5-57582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4.

Specifications

• Accession Number: Q96HR8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92345
• Name: Human NAF1 (aa 242-335) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Gm174; H/ACA ribonucleoprotein complex non-core subunit NAF1; hNAF1; NAF1; nuclear assembly factor 1 homolog; nuclear assembly factor 1 homolog (S. cerevisiae); nuclear assembly factor 1 ribonucleoprotein; RGD1306802
• Common Name: NAF1
• Gene Symbol: NAF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EIFGPVAHPFYVLRFNSSDHIESKGIKIKETMYFAPSMKDFTQYIFTEKLKQDKGSDASWKNDQEPPPEALDFSDDEKEKEAKQRKKSQIQGRK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining