Invitrogen™ Human NACAD (aa 996-1075) Control Fragment Recombinant Protein

Product Code. 30209385

Brand: Invitrogen™ RP109693

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May prevent inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). May bind to nascent polypeptide chains as they emerge from the ribosome and block their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. May also reduce the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).

Specifications

• Accession Number: O15069
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23148
• Name: Human NACAD (aa 996-1075) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D230024G13Rik; Kiaa0363; mKIAA0363; NAC alpha domain containing; NACAD; NAC-alpha domain-containing protein 1
• Common Name: NACAD
• Gene Symbol: NACAD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DQVQQDDPQPAAEAGTPWAAQEDADSTLGMEALSLPEPASGAGEEIAEALSRPGREACLEARAHTGDGAKPDSPQKETLE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining