Invitrogen™ Human NAA40 (aa 75-146) Control Fragment Recombinant Protein

Product Code. 30196067

Brand: Invitrogen™ RP97302

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58121 (PA5-58121. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-terminal acetylation is one of the most common protein modifications in eukaryotes, occurring on approximately 57% and 84% on yeast and human proteins respectively. There are several N-terminal acetylating enzyme complexes (NatA - NatE). Unlike the other complexes, NatD is composed of a single protein, NAT11, and has recently been described to acetylate the Serine N-termini of histones H2A and H4 in yeast. The role these modifications play is unknown; yeast that do not express NAT11 grow at normal rates and have no observable phenotypes. The role of the human homolog is likewise unknown.

Specifications

• Accession Number: Q86UY6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79829
• Name: Human NAA40 (aa 75-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4931433E08Rik; AU023197; N(alpha)-acetyltransferase 40, NatD catalytic subunit; N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog; N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae); Naa40; N-acetyltransferase 11; N-acetyltransferase 11 (GCN5-related, putative); N-alpha acetyl transferase 40; Nalpha acetyltransferase 40; N-alpha-acetyltransferase 40; N-alpha-acetyltransferase 40, NatD catalytic subunit; N-alpha-acetyltransferase D; NAT11; NatD; natD catalytic subunit; PATT1; Protein acetyltransferase 1
• Common Name: NAA40
• Gene Symbol: NAA40
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining