Invitrogen™ Human N6AMT1 (aa 148-212) Control Fragment Recombinant Protein

Artikelnummer. 30210664

missing translation for 'mfr': Invitrogen™ RP106922

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66242 (PA5-66242. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.

Spezifikation

• Accession Number: Q9Y5N5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29104
• Name: Human N6AMT1 (aa 148-212) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830445C04Rik; C21orf127; HemK methyltransferase family member 2; HEMK2; m.HsaHemK2P; Methylarsonite methyltransferase N6AMT1; Methyltransferase N6AMT1; methyltransferase N6AMT1; hemK methyltransferase family member 2; M-N6DNA MTase A; MTQ2; N(6)-adenine-specific DNA methyltransferase 1; N(6)-adenine-specific DNA methyltransferase 1-like; N-6 adenine-specific DNA methyltransferase 1; N-6 adenine-specific DNA methyltransferase 1 (putative); N6AMT; N6amt1; N6-DNA methyltransferase A; N6-DNA-methyltransferase; PRED28; Protein N(5)-glutamine methyltransferase; RGD1311843
• Common Name: N6AMT1
• Gene Symbol: N6AMT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining