missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210664

Invitrogen™ Human N6AMT1 (aa 148-212) Control Fragment Recombinant Protein

Product Code. 30210664
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210664

Brand: Invitrogen™ RP106922

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66242 (PA5-66242. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y5N5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29104
Name Human N6AMT1 (aa 148-212) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830445C04Rik; C21orf127; HemK methyltransferase family member 2; HEMK2; m.HsaHemK2P; Methylarsonite methyltransferase N6AMT1; Methyltransferase N6AMT1; methyltransferase N6AMT1; hemK methyltransferase family member 2; M-N6DNA MTase A; MTQ2; N(6)-adenine-specific DNA methyltransferase 1; N(6)-adenine-specific DNA methyltransferase 1-like; N-6 adenine-specific DNA methyltransferase 1; N-6 adenine-specific DNA methyltransferase 1 (putative); N6AMT; N6amt1; N6-DNA methyltransferase A; N6-DNA-methyltransferase; PRED28; Protein N(5)-glutamine methyltransferase; RGD1311843
Common Name N6AMT1
Gene Symbol N6AMT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.