Invitrogen™ Human N4BP2L2 (aa 539-656) Control Fragment Recombinant Protein

Product Code. 30182553

Brand: Invitrogen™ RP97966

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (19%), Rat (19%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58743 (PA5-58743. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N4BP2L2 (NEDD4-binding protein 2-like 2), also known as PFAAP5 (phosphonoformate immuno-associated protein 5), is a 583 amino acid nuclear protein that potentially is involved in transcriptional regulation. N4BP2L2 is phosphorylated on Ser 199 in response to DNA damage, probably by ATM or ATR. Primarily expressed in bone marrow, N4BP2L2 is dramatically down-regulated after exposure to arsenic compounds, an event which precedes neutropenia. PFAAP5 interacts with both Gfi-1 and Neutrophil Elastase, two proteins that are implicated in neutropenia disorders. Defects in the gene encoding Neutrophil Elastase, ELA2, are the cause of cyclic haematopoiesis, which, with decreased numbers of circulating neutrophils, leads to an increased risk for opportunistic infection.

Specifications

• Accession Number: Q92802
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10443
• Name: Human N4BP2L2 (aa 539-656) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700092H06Rik; 92M18.3; CG005; CG016; N4BP2L2; NEDD4 binding protein 2 like 2; NEDD4 binding protein 2-like 2; NEDD4-binding protein 2-like 2; PFAAP5; phosphonoformate immuno-associated protein 5; Phosphonoformate immuno-associated protein 5 homolog; protein from BRCA2 region; zag1
• Common Name: N4BP2L2
• Gene Symbol: N4BP2L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSEEENKQKLMTFDHHPLWFYLDIIKATPLNIDGQRYSHCLSFNRLRCSASLYKNYIPSFVLHNLSSIWKPSFTNKKLFLTFESQTRVGNKLNDAGFISPEILHSHPDTSCSLGVTSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining