missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human N4BP2L2 (aa 539-656) Control Fragment Recombinant Protein

Product Code. 30182553
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182553

Brand: Invitrogen™ RP97966

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (19%), Rat (19%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58743 (PA5-58743. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N4BP2L2 (NEDD4-binding protein 2-like 2), also known as PFAAP5 (phosphonoformate immuno-associated protein 5), is a 583 amino acid nuclear protein that potentially is involved in transcriptional regulation. N4BP2L2 is phosphorylated on Ser 199 in response to DNA damage, probably by ATM or ATR. Primarily expressed in bone marrow, N4BP2L2 is dramatically down-regulated after exposure to arsenic compounds, an event which precedes neutropenia. PFAAP5 interacts with both Gfi-1 and Neutrophil Elastase, two proteins that are implicated in neutropenia disorders. Defects in the gene encoding Neutrophil Elastase, ELA2, are the cause of cyclic haematopoiesis, which, with decreased numbers of circulating neutrophils, leads to an increased risk for opportunistic infection.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92802
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10443
Name Human N4BP2L2 (aa 539-656) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2700092H06Rik; 92M18.3; CG005; CG016; N4BP2L2; NEDD4 binding protein 2 like 2; NEDD4 binding protein 2-like 2; NEDD4-binding protein 2-like 2; PFAAP5; phosphonoformate immuno-associated protein 5; Phosphonoformate immuno-associated protein 5 homolog; protein from BRCA2 region; zag1
Common Name N4BP2L2
Gene Symbol N4BP2L2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NSEEENKQKLMTFDHHPLWFYLDIIKATPLNIDGQRYSHCLSFNRLRCSASLYKNYIPSFVLHNLSSIWKPSFTNKKLFLTFESQTRVGNKLNDAGFISPEILHSHPDTSCSLGVTSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.