Invitrogen™ Human N4BP2L1 (aa 53-100) Control Fragment Recombinant Protein

Product Code. 30197858

Brand: Invitrogen™ RP110027

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144861 (PA5-144861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N4BP2L1 (NEDD4 Binding Protein 2 Like 1) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includekinase activity. An important paralog of this gene isN4BP2.

Specifications

• Accession Number: Q5TBK1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90634
• Name: Human N4BP2L1 (aa 53-100) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410024N18Rik; AI428195; B230342M21Rik; CG018; CG081; hypothetical gene CG018; N4BP2L1; NEDD4 binding protein 2 like 1; NEDD4 binding protein 2-like 1; NEDD4-binding protein 2-like 1
• Common Name: N4BP2L1
• Gene Symbol: N4BP2L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining