Invitrogen™ Human N4BP2 (aa 886-973) Control Fragment Recombinant Protein

Product Code. 30206823

Brand: Invitrogen™ RP106030

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65335 (PA5-65335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Has 5'-polynucleotide kinase and nicking endonuclease activity. May play a role in DNA repair or recombination.

Specifications

• Accession Number: Q86UW6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55728
• Name: Human N4BP2 (aa 886-973) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B3BP; BCL-3-binding protein; KIAA1413; N4BP2; NEDD4 binding protein 2; NEDD4-binding protein 2
• Common Name: N4BP2
• Gene Symbol: N4BP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSSDSLAQREHRSRMPKTGLSEPNLEIGTNDKMNEISLSTAHEACWGTSSQKLKTLGSSNLGSSEMLLSEMTCESQTCLSKKSHGQHT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining