missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198724

Invitrogen™ Human N2DL4 (aa 139-224) Control Fragment Recombinant Protein

Product Code. 30198724
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198724

Brand: Invitrogen™ RP101432

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84180 (PA5-84180. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belong to the RAET1 family, which consists of major histocompatibility complex (MHC) class I-related genes located in a cluster on chromosome 6q24.2-q25.3. This and RAET1G protein differ from other RAET1 proteins in that they have type I membrane-spanning sequences at their C termini rather than glycosylphosphatidylinositol anchor sequences. This protein functions as a ligand for NKG2D receptor, which is expressed on the surface of several types of immune cells, and is involved in innate and adaptive immune responses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2011].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TD07
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 135250
Name Human N2DL4 (aa 139-224) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bA350J20.7; LETAL; Lymphocyte effector toxicity activation ligand; MGC125309; N2DL4; N2DL-4; NKG2D ligand 4; NKG2DL4; Rae-1 epsilon; RAE1 like transcript 4; RAE1epsilon; RAE-1-epsilon; RAE-1-like transcript 4; RAET1E; RAET1E2; Retinoic acid early transcript 1 E; retinoic acid early-inducible protein 1-epsilon; RL-4; UL16 binding protein 4; UL16-binding protein 4; ULBP 4; ULBP4; ULBP4MGC125308; UNQ1867/PRO4303
Common Name N2DL4
Gene Symbol RAET1E
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.