Invitrogen™ Human N-WASP (aa 396-479) Control Fragment Recombinant Protein

Product Code. 30193539

Brand: Invitrogen™ RP88621

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52198 (PA5-52198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes.

Specifications

• Accession Number: O00401
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8976
• Name: Human N-WASP (aa 396-479) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2900021I12Rik; 3110031I02Rik; DKFZp779G0847; MGC48327; n wasp; neural Wiskott-Aldrich syndrome protein; NWASP; N-WASP; TRS4; WASL; WASP like actin nucleation promoting factor; WASPB; Wiskott-Aldrich syndrome like; Wiskott-Aldrich syndrome-like; Wiskott-Aldrich syndrome-like (human)
• Common Name: N-WASP
• Gene Symbol: WASL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DHQVPTTAGNKAALLDQIREGAQLKKVEQNSRPVSCSGRDALLDQIRQGIQLKSVADGQESTPPTPAPTSGIVGALMEVMQKRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining