Invitrogen™ Human N-cadherin (aa 438-524) Control Fragment Recombinant Protein

Product Code. 30206502

Brand: Invitrogen™ RP103335

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-cadherin is a 140 kDa protein belonging to a family of transmembrane molecules that mediate calcium-dependent intercellular adhesion. Cadherins are involved in controlling morphogenetic movements during development and regulate cell surface adhesion through homotypic adhesion with the same cadherin species. N-cadherin's function is dependent on its association with the actin-cytoskeleton and is mediated through interactions between the C-terminal region of N-cadherin and the cytoplasmic catenin proteins. The stability of this association is regulated by phosphorylation and dephosphorylation of beta-catenin. Further, N-cadherin is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry.

Specifications

• Accession Number: P19022
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 1000
• Name: Human N-cadherin (aa 438-524) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: bib; cadherin 2; cadherin 2 L homeolog; cadherin 2 type 1 N-cadherin (neuronal); cadherin 2, neuronal; cadherin 2, type 1 preproprotein; cadherin 2, type 1, N-cadherin (neuronal); cadherin 2, type 1, N-cadherin (neuronal) L homeolog; cadherin 2, type 1, N-cadherin a (neuronal); Cadherin2; cadherin-2; Cadherin-2 A; Cadherin-N; calcium-dependent adhesion protein, neuronal; CD325; CDH2; cdh2.L; cdh2a; cdh2-a; cdh2-b; CDHN; cdhn-a; CDw325; CDw325 antigen; cell adhesion molecule; glass onion; glo; I79_014914; labyrinth; lyr; NCAD; N-Cad; N-cadherin; N-cadherin 1; N-cadherin A; N-cadherin precursor; N-cadherin-2; neural cadherin; Neural cadherin A; neural cadherin-2; neural calcium-dependent cell adhesion molecule; neural-cadherin; pac; Parachute; unnamed protein product; wu:fb47h04; XELAEV_18031953mg; ZNCAD
• Common Name: N-cadherin
• Gene Symbol: CDH2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining