missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human N-cadherin (aa 438-524) Control Fragment Recombinant Protein

Product Code. 30206502
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206502

Brand: Invitrogen™ RP103335

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N-cadherin is a 140 kDa protein belonging to a family of transmembrane molecules that mediate calcium-dependent intercellular adhesion. Cadherins are involved in controlling morphogenetic movements during development and regulate cell surface adhesion through homotypic adhesion with the same cadherin species. N-cadherin's function is dependent on its association with the actin-cytoskeleton and is mediated through interactions between the C-terminal region of N-cadherin and the cytoplasmic catenin proteins. The stability of this association is regulated by phosphorylation and dephosphorylation of beta-catenin. Further, N-cadherin is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. The protein functions during gastrulation and is required for establishment of left-right asymmetry.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19022
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1000
Name Human N-cadherin (aa 438-524) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bib; cadherin 2; cadherin 2 L homeolog; cadherin 2 type 1 N-cadherin (neuronal); cadherin 2, neuronal; cadherin 2, type 1 preproprotein; cadherin 2, type 1, N-cadherin (neuronal); cadherin 2, type 1, N-cadherin (neuronal) L homeolog; cadherin 2, type 1, N-cadherin a (neuronal); Cadherin2; cadherin-2; Cadherin-2 A; Cadherin-N; calcium-dependent adhesion protein, neuronal; CD325; CDH2; cdh2.L; cdh2a; cdh2-a; cdh2-b; CDHN; cdhn-a; CDw325; CDw325 antigen; cell adhesion molecule; glass onion; glo; I79_014914; labyrinth; lyr; NCAD; N-Cad; N-cadherin; N-cadherin 1; N-cadherin A; N-cadherin precursor; N-cadherin-2; neural cadherin; Neural cadherin A; neural cadherin-2; neural calcium-dependent cell adhesion molecule; neural-cadherin; pac; Parachute; unnamed protein product; wu:fb47h04; XELAEV_18031953mg; ZNCAD
Common Name N-cadherin
Gene Symbol CDH2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.