Invitrogen™ Human MZB1 (aa 28-94) Control Fragment Recombinant Protein

Product Code. 30193826

missing translation for 'mfr': Invitrogen™ RP104951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84122 (PA5-84122. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MZB1 associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.; Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.

Specifications

• Accession Number: Q8WU39
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51237
• Name: Human MZB1 (aa 28-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: caspase-2 binding protein; HSPC190; marginal zone B and B1 cell specific protein; marginal zone B and B1 cell-specific protein; marginal zone B- and B1-cell-specific protein; MEDA7; MEDA-7; Mesenteric estrogen-dependent adipose 7; mesenteric oestrogen-dependent adipose gene- 7; MGC29506; MZB1; PACAP; pERp1; plasma cell-induced ER protein 1; plasma cell-induced resident endoplasmic reticulum protein; Plasma cell-induced resident ER protein; proapoptotic caspase adapter protein; proapoptotic caspase adaptor protein
• Common Name: MZB1
• Gene Symbol: MZB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining